![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
![]() | Protein automated matches [190824] (23 species) not a true protein |
![]() | Species Neisseria gonorrhoeae [TaxId:242231] [255756] (4 PDB entries) |
![]() | Domain d5ue6a1: 5ue6 A:49-203 [329335] Other proteins in same PDB: d5ue6a2, d5ue6b2, d5ue6c2, d5ue6d2, d5ue6e2, d5ue6f2, d5ue6g2, d5ue6h2, d5ue6i2 automated match to d1kbva1 complexed with cu, na |
PDB Entry: 5ue6 (more details), 2.35 Å
SCOPe Domain Sequences for d5ue6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ue6a1 b.6.1.0 (A:49-203) automated matches {Neisseria gonorrhoeae [TaxId: 242231]} tpagelpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvp grmirvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqp glyiyhcavapvgmhiangmyglilvepkeglpkv
Timeline for d5ue6a1: