Lineage for d5tqgl_ (5tqg L:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2581531Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2582603Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2582604Family g.3.11.1: EGF-type module [57197] (23 protein domains)
  6. 2582613Protein Coagulation factor VIIa [57201] (1 species)
  7. 2582614Species Human (Homo sapiens) [TaxId:9606] [57202] (96 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 2582669Domain d5tqgl_: 5tqg L: [329330]
    Other proteins in same PDB: d5tqgh_
    automated match to d1cvwl_
    complexed with 7ks, ca, gol, so4

Details for d5tqgl_

PDB Entry: 5tqg (more details), 1.9 Å

PDB Description: factor viia in complex with the inhibitor (5r,11r)-11-[(1-amino-4- fluoroisoquinolin-6-yl)amino]-16-(cyclopropylsulfonyl)-7-(2,2- difluoroethoxy)-5,13-dimethyl-2,13-diazatricyclo[13.3.1.1~6, 10~]icosa-1(19),6(20),7,9,15,17-hexaene-3,12-dione
PDB Compounds: (L:) Factor VIIa (Light Chain)

SCOPe Domain Sequences for d5tqgl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tqgl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

SCOPe Domain Coordinates for d5tqgl_:

Click to download the PDB-style file with coordinates for d5tqgl_.
(The format of our PDB-style files is described here.)

Timeline for d5tqgl_: