Lineage for d5uj5a1 (5uj5 A:5-132)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503073Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2503459Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2503460Protein automated matches [191164] (22 species)
    not a true protein
  7. 2503492Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [329326] (1 PDB entry)
  8. 2503493Domain d5uj5a1: 5uj5 A:5-132 [329327]
    Other proteins in same PDB: d5uj5a2
    automated match to d2mjea_
    complexed with fes

Details for d5uj5a1

PDB Entry: 5uj5 (more details)

PDB Description: solution structure of the oxidized iron-sulfur protein adrenodoxin from encephalitozoon cuniculi. seattle structural genomics center for infectious disease target encua.00705.a
PDB Compounds: (A:) adrenodoxin

SCOPe Domain Sequences for d5uj5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uj5a1 d.15.4.0 (A:5-132) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
mdmfsapdripeqiriffktmkqvvpakavcgstvldvahkngvdlegacegnlacstch
vileeplyrklgepsdkeydlidqafgatgtsrlgcqlrvdksfenavftvpratknmav
dgfkpkph

SCOPe Domain Coordinates for d5uj5a1:

Click to download the PDB-style file with coordinates for d5uj5a1.
(The format of our PDB-style files is described here.)

Timeline for d5uj5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5uj5a2