SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uj5a1 (5uj5 A:5-132)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2159798Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2160171Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2160172Protein automated matches [191164] (21 species)
    not a true protein
  7. 2286025Species Encephalitozoon cuniculi [TaxId:6035] [329326] (1 PDB entry)
  8. 2286026Domain d5uj5a1: 5uj5 A:5-132 [329327]
    Other proteins in same PDB: d5uj5a2
    automated match to d2mjea_
    complexed with fes

Details for d5uj5a1

PDB Entry: 5uj5 (more details)

PDB Description: solution structure of the oxidized iron-sulfur protein adrenodoxin from encephalitozoon cuniculi. seattle structural genomics center for infectious disease target encua.00705.a
PDB Compounds: (A:) adrenodoxin

SCOPe Domain Sequences for d5uj5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uj5a1 d.15.4.0 (A:5-132) automated matches {Encephalitozoon cuniculi [TaxId: 6035]}
mdmfsapdripeqiriffktmkqvvpakavcgstvldvahkngvdlegacegnlacstch
vileeplyrklgepsdkeydlidqafgatgtsrlgcqlrvdksfenavftvpratknmav
dgfkpkph

SCOPe Domain Coordinates for d5uj5a1:

Click to download the PDB-style file with coordinates for d5uj5a1.
(The format of our PDB-style files is described here.)

Timeline for d5uj5a1:

  • d5uj5a1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5uj5a2