Lineage for d5uiza_ (5uiz A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2033030Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2033031Protein automated matches [190226] (53 species)
    not a true protein
  7. 2033296Species Thermobifida fusca [TaxId:2021] [256269] (2 PDB entries)
  8. 2286024Domain d5uiza_: 5uiz A: [329325]
    automated match to d4gboa_
    complexed with cu, gol, iod

Details for d5uiza_

PDB Entry: 5uiz (more details), 2 Å

PDB Description: structure of t.fusca aa10a
PDB Compounds: (A:) aa10a

SCOPe Domain Sequences for d5uiza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uiza_ b.1.18.0 (A:) automated matches {Thermobifida fusca [TaxId: 2021]}
hgsvinpatrnygcwlrwghdhlnpnmqyedpmcwqawqdnpnamwnwnglyrdwvggnh
raalpdgqlcsgglteggryrsmdavgpwkttdvnntftihlydqashgadyflvyvtkq
gfdpttqpltwdslelvhqtgsyppaqniqftvhapnrsgrhvvftiwkashmdqtyylc
sdvnfv

SCOPe Domain Coordinates for d5uiza_:

Click to download the PDB-style file with coordinates for d5uiza_.
(The format of our PDB-style files is described here.)

Timeline for d5uiza_:

  • d5uiza_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02