SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tqel_ (5tqe L:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2229389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2230373Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2230374Family g.3.11.1: EGF-type module [57197] (23 protein domains)
  6. 2230383Protein Coagulation factor VIIa [57201] (1 species)
  7. 2230384Species Human (Homo sapiens) [TaxId:9606] [57202] (64 PDB entries)
    Uniprot P08709 108-202 ! Uniprot P08709 107-202
  8. 2286022Domain d5tqel_: 5tqe L: [329323]
    Other proteins in same PDB: d5tqeh_
    automated match to d1cvwl_
    complexed with 7kq, ca, gol, so4

Details for d5tqel_

PDB Entry: 5tqe (more details), 1.9 Å

PDB Description: factor viia in complex with the inhibitor (5r)-5-[(1-aminoisoquinolin- 6-yl)amino]-19-(cyclopropylsulfonyl)-3-methyl-13-oxa-3,15- diazatricyclo[14.3.1.1~6,10~]henicosa-1(20),6(21),7,9,16,18-hexaene- 4,14-dione
PDB Compounds: (L:) Factor VIIa (Light Chain)

SCOPe Domain Sequences for d5tqel_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tqel_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

SCOPe Domain Coordinates for d5tqel_:

Click to download the PDB-style file with coordinates for d5tqel_.
(The format of our PDB-style files is described here.)

Timeline for d5tqel_:

  • d5tqel_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02