SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5uizb_ (5uiz B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2033030Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2033031Protein automated matches [190226] (50 species)
    not a true protein
  7. 2033296Species Thermobifida fusca [TaxId:2021] [256269] (2 PDB entries)
  8. 2286019Domain d5uizb_: 5uiz B: [329320]
    automated match to d4gboa_
    complexed with cu, gol, iod

Details for d5uizb_

PDB Entry: 5uiz (more details), 2 Å

PDB Description: structure of t.fusca aa10a
PDB Compounds: (B:) aa10a

SCOPe Domain Sequences for d5uizb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5uizb_ b.1.18.0 (B:) automated matches {Thermobifida fusca [TaxId: 2021]}
hgsvinpatrnygcwlrwghdhlnpnmqyedpmcwqawqdnpnamwnwnglyrdwvggnh
raalpdgqlcsgglteggryrsmdavgpwkttdvnntftihlydqashgadyflvyvtkq
gfdpttqpltwdslelvhqtgsyppaqniqftvhapnrsgrhvvftiwkashmdqtyylc
sdvnfv

SCOPe Domain Coordinates for d5uizb_:

Click to download the PDB-style file with coordinates for d5uizb_.
(The format of our PDB-style files is described here.)

Timeline for d5uizb_:

  • d5uizb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02