Lineage for d5tpub_ (5tpu B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2080272Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2080920Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2080921Protein automated matches [190388] (23 species)
    not a true protein
  7. 2080933Species Campylobacter jejuni [TaxId:197] [329306] (1 PDB entry)
  8. 2080935Domain d5tpub_: 5tpu B: [329311]
    Other proteins in same PDB: d5tpua2, d5tpud2
    automated match to d2pa7a1
    complexed with cl, tyd

Details for d5tpub_

PDB Entry: 5tpu (more details), 2 Å

PDB Description: x-ray structure of the wlarb tdp-quinovose 3,4-ketoisomerase from campylobacter jejuni
PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d5tpub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tpub_ b.82.1.0 (B:) automated matches {Campylobacter jejuni [TaxId: 197]}
iknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknleqvli
mmsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfydaaay
irnydeflrn

SCOPe Domain Coordinates for d5tpub_:

Click to download the PDB-style file with coordinates for d5tpub_.
(The format of our PDB-style files is described here.)

Timeline for d5tpub_: