Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.0: automated matches [191354] (1 protein) not a true family |
Protein automated matches [190388] (23 species) not a true protein |
Species Campylobacter jejuni [TaxId:197] [329306] (1 PDB entry) |
Domain d5tpub_: 5tpu B: [329311] Other proteins in same PDB: d5tpua2, d5tpud2 automated match to d2pa7a1 complexed with cl, tyd |
PDB Entry: 5tpu (more details), 2 Å
SCOPe Domain Sequences for d5tpub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tpub_ b.82.1.0 (B:) automated matches {Campylobacter jejuni [TaxId: 197]} iknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknleqvli mmsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfydaaay irnydeflrn
Timeline for d5tpub_: