SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5mx3l2 (5mx3 L:113-218)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (466 PDB entries)
  8. 2286009Domain d5mx3l2: 5mx3 L:113-218 [329310]
    Other proteins in same PDB: d5mx3b1, d5mx3l1
    automated match to d4oz4b2

Details for d5mx3l2

PDB Entry: 5mx3 (more details), 2.98 Å

PDB Description: structure of dc8e8 fab crystallized at ph 8.5
PDB Compounds: (L:) antibody kappa chain

SCOPe Domain Sequences for d5mx3l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mx3l2 b.1.1.2 (L:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvrwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d5mx3l2:

Click to download the PDB-style file with coordinates for d5mx3l2.
(The format of our PDB-style files is described here.)

Timeline for d5mx3l2:

  • d5mx3l2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5mx3l1