SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tpua1 (5tpu A:1-132)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070601Family b.82.1.0: automated matches [191354] (1 protein)
    not a true family
  6. 2070602Protein automated matches [190388] (21 species)
    not a true protein
  7. 2286005Species Campylobacter jejuni [TaxId:197] [329306] (1 PDB entry)
  8. 2286006Domain d5tpua1: 5tpu A:1-132 [329307]
    Other proteins in same PDB: d5tpua2, d5tpud2
    automated match to d2pa7a1
    complexed with cl, tyd

Details for d5tpua1

PDB Entry: 5tpu (more details), 2 Å

PDB Description: x-ray structure of the wlarb tdp-quinovose 3,4-ketoisomerase from campylobacter jejuni
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d5tpua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tpua1 b.82.1.0 (A:1-132) automated matches {Campylobacter jejuni [TaxId: 197]}
miknckilnlrairdnrgslialennkevpfeikrvyyifdtdpnfprgahahknleqvl
immsgscdiilndgknyekiclnrpdiglyigknmwremknfsygakllvlasdfydaaa
yirnydeflrni

SCOPe Domain Coordinates for d5tpua1:

Click to download the PDB-style file with coordinates for d5tpua1.
(The format of our PDB-style files is described here.)

Timeline for d5tpua1:

  • d5tpua1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02