SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tb7b1 (5tb7 B:53-203)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2037693Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2037694Protein automated matches [190824] (22 species)
    not a true protein
  7. 2037894Species Neisseria gonorrhoeae [TaxId:242231] [255756] (4 PDB entries)
  8. 2285998Domain d5tb7b1: 5tb7 B:53-203 [329299]
    Other proteins in same PDB: d5tb7a2, d5tb7b2, d5tb7c2
    automated match to d1kbva1
    complexed with cu, po4

Details for d5tb7b1

PDB Entry: 5tb7 (more details), 1.9 Å

PDB Description: structure of nitrite reductase ania from neisseria gonorrhoeae, space group p212121
PDB Compounds: (B:) nitrite reductase

SCOPe Domain Sequences for d5tb7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tb7b1 b.6.1.0 (B:53-203) automated matches {Neisseria gonorrhoeae [TaxId: 242231]}
elpvidavtthapevppaidrdypakvrvkmetvektmkmddgveyrywtfdgdvpgrmi
rvregdtvevefsnnpsstvphnvdfhaatgqgggaaatftapgrtstfsfkalqpglyi
yhcavapvgmhiangmyglilvepkeglpkv

SCOPe Domain Coordinates for d5tb7b1:

Click to download the PDB-style file with coordinates for d5tb7b1.
(The format of our PDB-style files is described here.)

Timeline for d5tb7b1:

  • d5tb7b1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02