SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t4tb_ (5t4t B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (79 species)
    not a true protein
  7. 2136616Species Rhodopseudomonas palustris [TaxId:1076] [267879] (9 PDB entries)
  8. 2285994Domain d5t4tb_: 5t4t B: [329295]
    Other proteins in same PDB: d5t4ta2
    automated match to d3r40a_
    complexed with act

Details for d5t4tb_

PDB Entry: 5t4t (more details), 1.51 Å

PDB Description: crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn - apo no halide
PDB Compounds: (B:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d5t4tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t4tb_ c.69.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
adlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkvivad
lpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrlaldsp
grlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkaklas
wtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvpm
lalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffs

SCOPe Domain Coordinates for d5t4tb_:

Click to download the PDB-style file with coordinates for d5t4tb_.
(The format of our PDB-style files is described here.)

Timeline for d5t4tb_:

  • d5t4tb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02