Lineage for d5ml2b_ (5ml2 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039078Family b.1.18.8: RhoGDI-like [81288] (3 proteins)
  6. 2039079Protein GMP-PDE delta [74846] (1 species)
  7. 2039080Species Human (Homo sapiens) [TaxId:9606] [74847] (23 PDB entries)
  8. 2039088Domain d5ml2b_: 5ml2 B: [329291]
    automated match to d3t5gb_
    complexed with nh6

Details for d5ml2b_

PDB Entry: 5ml2 (more details), 1.6 Å

PDB Description: the crystal structure of pde6d in complex with inhibitor-3
PDB Compounds: (B:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

SCOPe Domain Sequences for d5ml2b_:

Sequence, based on SEQRES records: (download)

>d5ml2b_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpas
vltgnviietkffdddllvstsrvrlfyv

Sequence, based on observed residues (ATOM records): (download)

>d5ml2b_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieammpasvltgn
viietkffdddllvstsrvrlfyv

SCOPe Domain Coordinates for d5ml2b_:

Click to download the PDB-style file with coordinates for d5ml2b_.
(The format of our PDB-style files is described here.)

Timeline for d5ml2b_: