SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5l38f_ (5l38 F:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2177851Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2177931Family d.58.56.0: automated matches [195116] (1 protein)
    not a true family
  6. 2177932Protein automated matches [195117] (11 species)
    not a true protein
  7. 2285958Species Mycobacterium smegmatis [TaxId:246196] [329259] (1 PDB entry)
  8. 2285984Domain d5l38f_: 5l38 F: [329285]
    automated match to d3mpwe_
    complexed with cl, na

Details for d5l38f_

PDB Entry: 5l38 (more details), 2.2 Å

PDB Description: the structure of the hexagonal shell protein msm0272 from the rmm microcompartment
PDB Compounds: (F:) MSM0272 - RMM microcompartment shell protein

SCOPe Domain Sequences for d5l38f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l38f_ d.58.56.0 (F:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
ssnaiglietkgyvaalaaadamvkaanvtitdrqqvgdglvavivtgevgavkaateag
aetasqvgelvsvhviprphselgahfsvs

SCOPe Domain Coordinates for d5l38f_:

Click to download the PDB-style file with coordinates for d5l38f_.
(The format of our PDB-style files is described here.)

Timeline for d5l38f_:

  • d5l38f_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02