SCOP 1.55: Domain d6gswb2: 6gsw B:1-84

Lineage for d6gswb2 (6gsw B:1-84)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Glutathione S-transferase [52863] (22 species)

7. Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)

8. Domain d6gswb2: 6gsw B:1-84 [32928]
   Other proteins in same PDB: d6gswa1, d6gswb1

Details for d6gswb2

PDB Entry: 6gsw, 1.85 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase

SCOP Domain Sequences for d6gswb2:

Sequence; same for both SEQRES and ATOM records:

>d6gswb2 c.47.1.5 (B:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgywnvrglvhpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

Timeline for d6gswb2:

• d6gswb2 appears in SCOP 1.57
  
• d6gswb2 appears in the current release, SCOPe 2.08