SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hydc_ (5hyd C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994353Family a.39.1.2: S100 proteins [47478] (2 protein domains)
    dimer: subunits are made of two EF-hands
  6. 1994573Protein automated matches [190132] (4 species)
    not a true protein
  7. 1994576Species Human (Homo sapiens) [TaxId:9606] [187203] (41 PDB entries)
  8. 2285978Domain d5hydc_: 5hyd C: [329279]
    automated match to d2y5ic_

Details for d5hydc_

PDB Entry: 5hyd (more details), 2.3 Å

PDB Description: crystal structure of calcium-free human s100z
PDB Compounds: (C:) Protein S100-Z

SCOPe Domain Sequences for d5hydc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hydc_ a.39.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptqlemamdtmirifhrysgkerkrfklskgelklllqrelteflscqketqlvdkivqd
ldankdnevdfnefvvmvaaltvacndyfveqlk

SCOPe Domain Coordinates for d5hydc_:

Click to download the PDB-style file with coordinates for d5hydc_.
(The format of our PDB-style files is described here.)

Timeline for d5hydc_:

  • d5hydc_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02