SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ml6b_ (5ml6 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2032608Family b.1.18.8: RhoGDI-like [81288] (3 protein domains)
  6. 2032609Protein GMP-PDE delta [74846] (1 species)
  7. 2032610Species Human (Homo sapiens) [TaxId:9606] [74847] (19 PDB entries)
  8. 2285974Domain d5ml6b_: 5ml6 B: [329275]
    automated match to d3t5gb_
    complexed with 9gd

Details for d5ml6b_

PDB Entry: 5ml6 (more details), 1.87 Å

PDB Description: the crystal structure of pde6d in complex to inhibitor-8
PDB Compounds: (B:) Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta

SCOPe Domain Sequences for d5ml6b_:

Sequence, based on SEQRES records: (download)

>d5ml6b_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmmpas
vltgnviietkffdddllvstsrvrlfyv

Sequence, based on observed residues (ATOM records): (download)

>d5ml6b_ b.1.18.8 (B:) GMP-PDE delta {Human (Homo sapiens) [TaxId: 9606]}
sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqsliesqmmpasvltg
nviietkffdddllvstsrvrlfyv

SCOPe Domain Coordinates for d5ml6b_:

Click to download the PDB-style file with coordinates for d5ml6b_.
(The format of our PDB-style files is described here.)

Timeline for d5ml6b_:

  • d5ml6b_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02