Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies) this is not a true fold; contains at least two very long antiparallel helices |
Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) Pfam PF16454 |
Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 proteins) |
Protein automated matches [310859] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [311240] (3 PDB entries) |
Domain d5m6ub_: 5m6u B: [329273] automated match to d2v1yb_ complexed with 7ka |
PDB Entry: 5m6u (more details), 2.85 Å
SCOPe Domain Sequences for d5m6ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m6ub_ h.4.21.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnetikife eqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlkkqaae yreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg
Timeline for d5m6ub_: