SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5m6ub_ (5m6u B:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2239862Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 2240026Superfamily h.4.21: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 (iSH2) domain-like [310606] (1 family) (S)
    Pfam PF16454
  5. 2240027Family h.4.21.1: Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain-like [310658] (2 protein domains)
  6. 2240031Protein automated matches [310859] (2 species)
    not a true protein
  7. 2240035Species Human (Homo sapiens) [TaxId:9606] [311240] (2 PDB entries)
  8. 2285972Domain d5m6ub_: 5m6u B: [329273]
    automated match to d2v1yb_
    complexed with 7ka

Details for d5m6ub_

PDB Entry: 5m6u (more details), 2.85 Å

PDB Description: human pi3kdelta in complex with lasw1579
PDB Compounds: (B:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d5m6ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5m6ub_ h.4.21.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvkednieavgkklheyntqfqeksreydrlyedytrtsqeiqmkrtaieafnetikife
eqcqtqeryskeyiekfkregneteiqrimhnyeklksriseivdsrrrleedlkkqaae
yreidkrmnsikpdliqlrktrdqylmwltqkgvrqkklnewlg

SCOPe Domain Coordinates for d5m6ub_:

Click to download the PDB-style file with coordinates for d5m6ub_.
(The format of our PDB-style files is described here.)

Timeline for d5m6ub_:

  • d5m6ub_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02