Lineage for d5k9ia_ (5k9i A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2195895Protein c-src tyrosine kinase [56155] (2 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2195896Species Chicken (Gallus gallus) [TaxId:9031] [56157] (47 PDB entries)
  8. 2285968Domain d5k9ia_: 5k9i A: [329269]
    automated match to d3f6xa_
    complexed with o44

Details for d5k9ia_

PDB Entry: 5k9i (more details), 2.5 Å

PDB Description: crystal structure of c-src in complex with a covalent lysine probe
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d5k9ia_:

Sequence, based on SEQRES records: (download)

>d5k9ia_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
aweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklr
heklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayve
rmnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygr
ftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqc
wrkdpeerptfeylqafledyftstepqyqpgenl

Sequence, based on observed residues (ATOM records): (download)

>d5k9ia_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
aweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklr
heklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayve
rmnyvhrdlraanilvgenlvckvadfgfpikwtapeaalygrftiksdvwsfgilltel
ttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqaf
ledyftstepqyqpgenl

SCOPe Domain Coordinates for d5k9ia_:

Click to download the PDB-style file with coordinates for d5k9ia_.
(The format of our PDB-style files is described here.)

Timeline for d5k9ia_:

  • d5k9ia_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02