SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k9ia_ (5k9i A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2195690Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 protein domains)
    members organized in the groups and subfamiles specified by the comments
  6. 2195895Protein c-src tyrosine kinase [56155] (2 species)
    PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase
  7. 2195896Species Chicken (Gallus gallus) [TaxId:9031] [56157] (43 PDB entries)
  8. 2285968Domain d5k9ia_: 5k9i A: [329269]
    automated match to d3f6xa_
    complexed with o44

Details for d5k9ia_

PDB Entry: 5k9i (more details), 2.5 Å

PDB Description: crystal structure of c-src in complex with a covalent lysine probe
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d5k9ia_:

Sequence, based on SEQRES records: (download)

>d5k9ia_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
aweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklr
heklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayve
rmnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygr
ftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqc
wrkdpeerptfeylqafledyftstepqyqpgenl

Sequence, based on observed residues (ATOM records): (download)

>d5k9ia_ d.144.1.7 (A:) c-src tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
aweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklr
heklvqlyavvseepiyivteymskgslldflkgemgkylrlpqlvdmaaqiasgmayve
rmnyvhrdlraanilvgenlvckvadfgfpikwtapeaalygrftiksdvwsfgilltel
ttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqaf
ledyftstepqyqpgenl

SCOPe Domain Coordinates for d5k9ia_:

Click to download the PDB-style file with coordinates for d5k9ia_.
(The format of our PDB-style files is described here.)

Timeline for d5k9ia_:

  • d5k9ia_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02