Lineage for d5i3dc_ (5i3d C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418013Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2418178Protein automated matches [190245] (11 species)
    not a true protein
  7. 2418202Species Sulfolobus solfataricus [TaxId:273057] [195161] (4 PDB entries)
  8. 2418211Domain d5i3dc_: 5i3d C: [329252]
    automated match to d4eama_
    complexed with act, pe8; mutant

Details for d5i3dc_

PDB Entry: 5i3d (more details), 2.16 Å

PDB Description: sulfolobus solfataricus beta-glycosidase - e387y mutant
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d5i3dc_:

Sequence, based on SEQRES records: (download)

>d5i3dc_ c.1.8.4 (C:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
sfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgywgn
yktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrldeya
nkdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvye
farfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqa
haraydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrgn
ekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgwe
ffpeglydvltkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvrgy
lhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvp
pvkplrh

Sequence, based on observed residues (ATOM records): (download)

>d5i3dc_ c.1.8.4 (C:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
sfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgywgn
yktfhdnaqkmglkiarlnvewsrifpnplpdvteveinenelkrldeyankdalnhyre
ifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvyefarfsayiaw
kfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqaharaydgiks
vskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrgnekivrddlkg
rldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgweffpeglydvl
tkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvrgylhwsladnye
wasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvppvkplrh

SCOPe Domain Coordinates for d5i3dc_:

Click to download the PDB-style file with coordinates for d5i3dc_.
(The format of our PDB-style files is described here.)

Timeline for d5i3dc_: