SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i3dc_ (5i3d C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083096Species Sulfolobus solfataricus [TaxId:273057] [195161] (4 PDB entries)
  8. 2285951Domain d5i3dc_: 5i3d C: [329252]
    automated match to d4eama_
    complexed with act, pe8; mutant

Details for d5i3dc_

PDB Entry: 5i3d (more details), 2.16 Å

PDB Description: sulfolobus solfataricus beta-glycosidase - e387y mutant
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d5i3dc_:

Sequence, based on SEQRES records: (download)

>d5i3dc_ c.1.8.4 (C:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
sfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgywgn
yktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrldeya
nkdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvye
farfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqa
haraydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrgn
ekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgwe
ffpeglydvltkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvrgy
lhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvp
pvkplrh

Sequence, based on observed residues (ATOM records): (download)

>d5i3dc_ c.1.8.4 (C:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
sfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgywgn
yktfhdnaqkmglkiarlnvewsrifpnplpdvteveinenelkrldeyankdalnhyre
ifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvyefarfsayiaw
kfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqaharaydgiks
vskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrgnekivrddlkg
rldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgweffpeglydvl
tkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvrgylhwsladnye
wasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvppvkplrh

SCOPe Domain Coordinates for d5i3dc_:

Click to download the PDB-style file with coordinates for d5i3dc_.
(The format of our PDB-style files is described here.)

Timeline for d5i3dc_:

  • d5i3dc_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02