Lineage for d5k3ea_ (5k3e A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (88 species)
    not a true protein
  7. 2285917Species Rhodopseudomonas palustris [TaxId:258594] [329218] (7 PDB entries)
  8. 2285950Domain d5k3ea_: 5k3e A: [329251]
    automated match to d3r40a_
    complexed with cl, goa

Details for d5k3ea_

PDB Entry: 5k3e (more details), 1.54 Å

PDB Description: crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/glycolate - cocrystallized
PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d5k3ea_:

Sequence, based on SEQRES records: (download)

>d5k3ea_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa

Sequence, based on observed residues (ATOM records): (download)

>d5k3ea_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgasgiaqstpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa

SCOPe Domain Coordinates for d5k3ea_:

Click to download the PDB-style file with coordinates for d5k3ea_.
(The format of our PDB-style files is described here.)

Timeline for d5k3ea_:

  • d5k3ea_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02