Lineage for d6gsva2 (6gsv A:1-84)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600814Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1601014Protein Class mu GST [81359] (3 species)
  7. 1601076Species Norway rat (Rattus norvegicus) [TaxId:10116] [52868] (16 PDB entries)
  8. 1601081Domain d6gsva2: 6gsv A:1-84 [32925]
    Other proteins in same PDB: d6gsva1, d6gsvb1
    complexed with gps, so4

Details for d6gsva2

PDB Entry: 6gsv (more details), 1.75 Å

PDB Description: first-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
PDB Compounds: (A:) mu class glutathione s-transferase of isoenzyme 3-3

SCOPe Domain Sequences for d6gsva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gsva2 c.47.1.5 (A:1-84) Class mu GST {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pmilgywnvrglshpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOPe Domain Coordinates for d6gsva2:

Click to download the PDB-style file with coordinates for d6gsva2.
(The format of our PDB-style files is described here.)

Timeline for d6gsva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6gsva1