SCOPe 2.06: Domain d5hw9a1: 5hw9 A:2-238

Lineage for d5hw9a1 (5hw9 A:2-238)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (54 PDB entries)

8. Domain d5hw9a1: 5hw9 A:2-238 [329242]
   Other proteins in same PDB: d5hw9a2
   automated match to d3st3a_

Details for d5hw9a1

PDB Entry: 5hw9, 3 Å

PDB Description: filamentous assembly of green fluorescent protein supported by a c- terminal fusion of 18-residues, viewed in space group p21

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d5hw9a1:

Sequence; same for both SEQRES and ATOM records:

>d5hw9a1 d.22.1.1 (A:2-238) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlv
ttfxlqcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagithgmdelyk

Timeline for d5hw9a1:

• d5hw9a1 is new in SCOPe 2.06-stable
  
• d5hw9a1 appears in SCOPe 2.07
  
• d5hw9a1 appears in the current release, SCOPe 2.08