Lineage for d5k3fa_ (5k3f A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2285917Species Rhodopseudomonas palustris [TaxId:258594] [329218] (7 PDB entries)
  8. 2285938Domain d5k3fa_: 5k3f A: [329239]
    automated match to d3r41b_
    complexed with cl

Details for d5k3fa_

PDB Entry: 5k3f (more details), 1.54 Å

PDB Description: crystal structure of the fluoroacetate dehalogenase rpa1163 - his280asn/fluoroacetate - cocrystallized - single protomer reacted with ligand
PDB Compounds: (A:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d5k3fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k3fa_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghdrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgasgiaqsaatpldvwrkwasdvqgapiesgnflpeeapdqtaealvrffsa

SCOPe Domain Coordinates for d5k3fa_:

Click to download the PDB-style file with coordinates for d5k3fa_.
(The format of our PDB-style files is described here.)

Timeline for d5k3fa_:

  • d5k3fa_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02