Lineage for d5hyda_ (5hyd A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994353Family a.39.1.2: S100 proteins [47478] (2 protein domains)
    dimer: subunits are made of two EF-hands
  6. 1994573Protein automated matches [190132] (4 species)
    not a true protein
  7. 1994576Species Human (Homo sapiens) [TaxId:9606] [187203] (42 PDB entries)
  8. 2285932Domain d5hyda_: 5hyd A: [329233]
    automated match to d2y5ic_

Details for d5hyda_

PDB Entry: 5hyd (more details), 2.3 Å

PDB Description: crystal structure of calcium-free human s100z
PDB Compounds: (A:) Protein S100-Z

SCOPe Domain Sequences for d5hyda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hyda_ a.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptqlemamdtmirifhrysgkerkrfklskgelklllqrelteflscqketqlvdkivqd
ldankdnevdfnefvvmvaaltvacndyfveqlkkk

SCOPe Domain Coordinates for d5hyda_:

Click to download the PDB-style file with coordinates for d5hyda_.
(The format of our PDB-style files is described here.)

Timeline for d5hyda_:

  • d5hyda_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02