Lineage for d5hy9a2 (5hy9 A:340-443)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2023282Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2023285Species Human (Homo sapiens) [TaxId:9606] [88590] (66 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2285930Domain d5hy9a2: 5hy9 A:340-443 [329231]
    Other proteins in same PDB: d5hy9a1, d5hy9b1
    automated match to d4dz8a2
    complexed with bma, fuc, gal, nag

Details for d5hy9a2

PDB Entry: 5hy9 (more details), 2.7 Å

PDB Description: glycosylated, disulfide-linked knob-into-hole fc fragment
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5hy9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hy9a2 b.1.1.2 (A:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppcrdeltknqvslwclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOPe Domain Coordinates for d5hy9a2:

Click to download the PDB-style file with coordinates for d5hy9a2.
(The format of our PDB-style files is described here.)

Timeline for d5hy9a2:

  • d5hy9a2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5hy9a1