Lineage for d2gsta2 (2gst A:1-84)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 181002Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (4 proteins)
  6. 181014Protein Glutathione S-transferase [52863] (27 species)
  7. 181240Species Rat (Rattus norvegicus), class mu [TaxId:10116] [52868] (14 PDB entries)
  8. 181241Domain d2gsta2: 2gst A:1-84 [32923]
    Other proteins in same PDB: d2gsta1, d2gstb1

Details for d2gsta2

PDB Entry: 2gst (more details), 1.8 Å

PDB Description: structure of the xenobiotic substrate binding site of a glutathione s- transferase as revealed by x-ray crystallographic analysis of product complexes with the diastereomers of 9-(s-glutathionyl)-10-hydroxy-9, 10-dihydrophenanthrene

SCOP Domain Sequences for d2gsta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsta2 c.47.1.5 (A:1-84) Glutathione S-transferase {Rat (Rattus norvegicus), class mu}
pmilgywnvrglthpirllleytdssyeekryamgdapdydrsqwlnekfklgldfpnlp
ylidgsrkitqsnaimrylarkhh

SCOP Domain Coordinates for d2gsta2:

Click to download the PDB-style file with coordinates for d2gsta2.
(The format of our PDB-style files is described here.)

Timeline for d2gsta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gsta1