SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5k3eb_ (5k3e B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (79 species)
    not a true protein
  7. 2285917Species Rhodopseudomonas palustris [TaxId:258594] [329218] (7 PDB entries)
  8. 2285928Domain d5k3eb_: 5k3e B: [329229]
    automated match to d3r40a_
    complexed with cl, goa

Details for d5k3eb_

PDB Entry: 5k3e (more details), 1.54 Å

PDB Description: crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/glycolate - cocrystallized
PDB Compounds: (B:) Fluoroacetate Dehalogenase

SCOPe Domain Sequences for d5k3eb_:

Sequence, based on SEQRES records: (download)

>d5k3eb_ c.69.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgasgiaqsaatpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa

Sequence, based on observed residues (ATOM records): (download)

>d5k3eb_ c.69.1.0 (B:) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
ladlfpgfgsewintssgrifarvggdgppllllhgfpqthvmwhrvapklaerfkviva
dlpgygwsdmpesdeqhtpytkramakqlieameqlghvhfalaghnrgarvsyrlalds
pgrlsklavldilptyeywqrmnrayalkiyhwsflaqpaplpenllggdpdfyvkakla
swtragdlsafdpravehyriafadpmrrhvmcedyragayadfehdkidveagnkipvp
mlalwgasgiaqtpldvwrkwasdvqgapiesghflpeeapdqtaealvrffsa

SCOPe Domain Coordinates for d5k3eb_:

Click to download the PDB-style file with coordinates for d5k3eb_.
(The format of our PDB-style files is described here.)

Timeline for d5k3eb_:

  • d5k3eb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02