Lineage for d5b8ac_ (5b8a C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (178 species)
    not a true protein
  7. 2458070Species Human (Homo sapiens) [TaxId:9606] [188013] (109 PDB entries)
  8. 2458317Domain d5b8ac_: 5b8a C: [329227]
    automated match to d4k1fa_
    complexed with gol, so4

Details for d5b8ac_

PDB Entry: 5b8a (more details), 2.7 Å

PDB Description: crystal structure of oxidized chimeric ecahpc1-186-yfskhn
PDB Compounds: (C:) Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2

SCOPe Domain Sequences for d5b8ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b8ac_ c.47.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpg

SCOPe Domain Coordinates for d5b8ac_:

Click to download the PDB-style file with coordinates for d5b8ac_.
(The format of our PDB-style files is described here.)

Timeline for d5b8ac_: