SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b8ac_ (5b8a C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116932Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2116933Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2118983Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2118984Protein automated matches [190056] (163 species)
    not a true protein
  7. 2119464Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries)
  8. 2285926Domain d5b8ac_: 5b8a C: [329227]
    automated match to d4k1fa_
    complexed with gol, so4

Details for d5b8ac_

PDB Entry: 5b8a (more details), 2.7 Å

PDB Description: crystal structure of oxidized chimeric ecahpc1-186-yfskhn
PDB Compounds: (C:) Alkyl hydroperoxide reductase subunit C,Peroxiredoxin-2

SCOPe Domain Sequences for d5b8ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b8ac_ c.47.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee
lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr
atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashpg

SCOPe Domain Coordinates for d5b8ac_:

Click to download the PDB-style file with coordinates for d5b8ac_.
(The format of our PDB-style files is described here.)

Timeline for d5b8ac_:

  • d5b8ac_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02