SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5i4ja_ (5i4j A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990537Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1990538Protein automated matches [190036] (36 species)
    not a true protein
  7. 2285537Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries)
  8. 2285924Domain d5i4ja_: 5i4j A: [329225]
    automated match to d4cybd_
    complexed with epe, zn

Details for d5i4ja_

PDB Entry: 5i4j (more details), 2.39 Å

PDB Description: dps4 from nostoc punctiforme in complex with zn ions
PDB Compounds: (A:) Ferritin, Dps family protein

SCOPe Domain Sequences for d5i4ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i4ja_ a.25.1.0 (A:) automated matches {Nostoc punctiforme [TaxId: 272131]}
tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef
fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae
qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa

SCOPe Domain Coordinates for d5i4ja_:

Click to download the PDB-style file with coordinates for d5i4ja_.
(The format of our PDB-style files is described here.)

Timeline for d5i4ja_:

  • d5i4ja_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02