Lineage for d5hyea1 (5hye A:236-339)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2023188Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 2023189Species Human (Homo sapiens) [TaxId:9606] [88585] (56 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2285920Domain d5hyea1: 5hye A:236-339 [329221]
    Other proteins in same PDB: d5hyea2, d5hyec2
    automated match to d1hzhk3
    complexed with bma, fuc, gal, nag

Details for d5hyea1

PDB Entry: 5hye (more details), 1.89 Å

PDB Description: glycosylated knob-knob fc fragment (p212121)
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5hyea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hyea1 b.1.1.2 (A:236-339) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d5hyea1:

Click to download the PDB-style file with coordinates for d5hyea1.
(The format of our PDB-style files is described here.)

Timeline for d5hyea1:

  • d5hyea1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5hyea2