Lineage for d5i4jc_ (5i4j C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704499Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries)
  8. 2704510Domain d5i4jc_: 5i4j C: [329215]
    automated match to d4cybd_
    complexed with epe, zn

Details for d5i4jc_

PDB Entry: 5i4j (more details), 2.39 Å

PDB Description: dps4 from nostoc punctiforme in complex with zn ions
PDB Compounds: (C:) Ferritin, Dps family protein

SCOPe Domain Sequences for d5i4jc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i4jc_ a.25.1.0 (C:) automated matches {Nostoc punctiforme [TaxId: 272131]}
tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef
fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae
qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa

SCOPe Domain Coordinates for d5i4jc_:

Click to download the PDB-style file with coordinates for d5i4jc_.
(The format of our PDB-style files is described here.)

Timeline for d5i4jc_: