Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Nostoc punctiforme [TaxId:272131] [328838] (3 PDB entries) |
Domain d5i4jc_: 5i4j C: [329215] automated match to d4cybd_ complexed with epe, zn |
PDB Entry: 5i4j (more details), 2.39 Å
SCOPe Domain Sequences for d5i4jc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i4jc_ a.25.1.0 (C:) automated matches {Nostoc punctiforme [TaxId: 272131]} tllrnfgnvydnpvlldrsvtapvtegfnvvlasfqalylqyqkhhfvvegsefyslhef fnesynqvqdhiheigerldglggvpvatfsklaeltcfeqesegvyssrqmvendlaae qaiigvirrqaaqaeslgdrgtrylyekillkteerayhlshflakdsltlgfvqaa
Timeline for d5i4jc_: