SCOPe 2.08: Domain d5h59a2: 5h59 A:158-317

Lineage for d5h59a2 (5h59 A:158-317)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (19 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [226538] (17 PDB entries)

8. Domain d5h59a2: 5h59 A:158-317 [329213]
   Other proteins in same PDB: d5h59a1
   automated match to d3lo8a2
   complexed with fad

Details for d5h59a2

PDB Entry: 5h59, 1.65 Å

PDB Description: ferredoxin-nadp+ reductase from maize root

PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d5h59a2:

Sequence; same for both SEQRES and ATOM records:

>d5h59a2 c.25.1.0 (A:158-317) automated matches {Maize (Zea mays) [TaxId: 4577]}
mllpeedpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllyd
eeftsylkqypdnfrydkvlsreqknrsggkmyvqdkieeysdeifklldggahiyfcgl
kgmmpgiqdtlkkvaerrgeswdqklaqlkknkqwhvevy

Timeline for d5h59a2:

• d5h59a2 first appeared in SCOPe 2.06
  
• d5h59a2 appears in SCOPe 2.07