SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h59a1 (5h59 A:7-157)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2054165Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2054655Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2054836Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2054837Protein automated matches [226870] (20 species)
    not a true protein
  7. 2054887Species Maize (Zea mays) [TaxId:4577] [226539] (7 PDB entries)
  8. 2285911Domain d5h59a1: 5h59 A:7-157 [329212]
    Other proteins in same PDB: d5h59a2
    automated match to d3lvba1
    complexed with fad

Details for d5h59a1

PDB Entry: 5h59 (more details), 1.65 Å

PDB Description: ferredoxin-nadp+ reductase from maize root
PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d5h59a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h59a1 b.43.4.0 (A:7-157) automated matches {Maize (Zea mays) [TaxId: 4577]}
srskvsvaplhlesakepplntykpkepftativsveslvgpkapgetchividhggnvp
ywegqsygvippgenpkkpgapqnvrlysiastrygdnfdgrtgslcvrravyydpetgk
edpskngvcsnflcnskpgdkiqltgpsgki

SCOPe Domain Coordinates for d5h59a1:

Click to download the PDB-style file with coordinates for d5h59a1.
(The format of our PDB-style files is described here.)

Timeline for d5h59a1:

  • d5h59a1 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5h59a2