SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hyec2 (5hye C:340-443)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2023282Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 2023285Species Human (Homo sapiens) [TaxId:9606] [88590] (65 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2285909Domain d5hyec2: 5hye C:340-443 [329210]
    Other proteins in same PDB: d5hyea1, d5hyec1
    automated match to d4dz8a2
    complexed with bma, fuc, gal, nag

Details for d5hyec2

PDB Entry: 5hye (more details), 1.89 Å

PDB Description: glycosylated knob-knob fc fragment (p212121)
PDB Compounds: (C:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d5hyec2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hyec2 b.1.1.2 (C:340-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppcrdeltknqvslwclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsl

SCOPe Domain Coordinates for d5hyec2:

Click to download the PDB-style file with coordinates for d5hyec2.
(The format of our PDB-style files is described here.)

Timeline for d5hyec2:

  • d5hyec2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5hyec1