Lineage for d5i3da_ (5i3d A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083096Species Sulfolobus solfataricus [TaxId:273057] [195161] (4 PDB entries)
  8. 2285906Domain d5i3da_: 5i3d A: [329207]
    automated match to d4eama_
    complexed with act, pe8; mutant

Details for d5i3da_

PDB Entry: 5i3d (more details), 2.16 Å

PDB Description: sulfolobus solfataricus beta-glycosidase - e387y mutant
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d5i3da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i3da_ c.1.8.4 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
sfpnsfrfgwsqagfqsemgtpgsedpntdwykwvhdpenmaaglvsgdlpengpgywgn
yktfhdnaqkmglkiarlnvewsrifpnplprpqnfdeskqdvteveinenelkrldeya
nkdalnhyreifkdlksrglyfilnmyhwplplwlhdpirvrrgdftgpsgwlstrtvye
farfsayiawkfddlvdeystmnepnvvgglgyvgvksgfppgylsfelsrramyniiqa
haraydgiksvskkpvgiiyanssfqpltdkdmeavemaendnrwwffdaiirgeitrgn
ekivrddlkgrldwigvnyytrtvvkrtekgyvslggyghgcernsvslaglptsdfgwe
ffpeglydvltkywnryhlymyvtyngiaddadyqrpyylvshvyqvhrainsgadvrgy
lhwsladnyewasgfsmrfgllkvdyntkrlywrpsalvyreiatngaitdeiehlnsvp
pvkplrh

SCOPe Domain Coordinates for d5i3da_:

Click to download the PDB-style file with coordinates for d5i3da_.
(The format of our PDB-style files is described here.)

Timeline for d5i3da_:

  • d5i3da_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02