Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
Protein automated matches [190231] (9 species) not a true protein |
Species Zea mays [TaxId:4577] [329187] (2 PDB entries) |
Domain d5h57c_: 5h57 C: [329205] automated match to d2pvgc_ complexed with fes |
PDB Entry: 5h57 (more details), 2.5 Å
SCOPe Domain Sequences for d5h57c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h57c_ d.15.4.1 (C:) automated matches {Zea mays [TaxId: 4577]} avykvklvgpegeehefdapddayildaaetagvelpyscragacstcagkiesgsvdqs dgsflddgqqeegyvltcvsypksdcvihthkegdly
Timeline for d5h57c_: