SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h57c_ (5h57 C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2159798Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2159799Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 protein domains)
  6. 2159928Protein automated matches [190231] (9 species)
    not a true protein
  7. 2285886Species Zea mays [TaxId:4577] [329187] (2 PDB entries)
  8. 2285904Domain d5h57c_: 5h57 C: [329205]
    automated match to d2pvgc_
    complexed with fes

Details for d5h57c_

PDB Entry: 5h57 (more details), 2.5 Å

PDB Description: ferredoxin iii from maize root
PDB Compounds: (C:) Ferredoxin-3, chloroplastic

SCOPe Domain Sequences for d5h57c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h57c_ d.15.4.1 (C:) automated matches {Zea mays [TaxId: 4577]}
avykvklvgpegeehefdapddayildaaetagvelpyscragacstcagkiesgsvdqs
dgsflddgqqeegyvltcvsypksdcvihthkegdly

SCOPe Domain Coordinates for d5h57c_:

Click to download the PDB-style file with coordinates for d5h57c_.
(The format of our PDB-style files is described here.)

Timeline for d5h57c_:

  • d5h57c_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02