Lineage for d5hwha_ (5hwh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108002Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2108003Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2108056Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2108057Protein automated matches [190499] (22 species)
    not a true protein
  7. 2285394Species Microbacterium hydrocarbonoxydans [TaxId:273678] [328695] (3 PDB entries)
  8. 2285902Domain d5hwha_: 5hwh A: [329203]
    automated match to d3mcwa_
    complexed with 66z

Details for d5hwha_

PDB Entry: 5hwh (more details), 1.79 Å

PDB Description: structure of a cysteine hydrolase with a positive substrate
PDB Compounds: (A:) Isochorismatase

SCOPe Domain Sequences for d5hwha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hwha_ c.33.1.0 (A:) automated matches {Microbacterium hydrocarbonoxydans [TaxId: 273678]}
prrtvvlaidlqagvtpgcfdeegvlsraaalveraraggvpvvwvhhdpvgvgtpewel
aaplhraegeplvrknyrdsfadttlretldelgathlvitgaqsdfavrttmqraaaeg
ydvtlvsdahttvdtewegvrisgeqivahtnmyfsglrypgqefviathdhval

SCOPe Domain Coordinates for d5hwha_:

Click to download the PDB-style file with coordinates for d5hwha_.
(The format of our PDB-style files is described here.)

Timeline for d5hwha_:

  • d5hwha_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02