SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hwha_ (5hwh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108002Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2108003Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2108056Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2108057Protein automated matches [190499] (21 species)
    not a true protein
  7. 2285394Species Microbacterium hydrocarbonoxydans [TaxId:273678] [328695] (3 PDB entries)
  8. 2285902Domain d5hwha_: 5hwh A: [329203]
    automated match to d3mcwa_
    complexed with 66z

Details for d5hwha_

PDB Entry: 5hwh (more details), 1.79 Å

PDB Description: structure of a cysteine hydrolase with a positive substrate
PDB Compounds: (A:) Isochorismatase

SCOPe Domain Sequences for d5hwha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hwha_ c.33.1.0 (A:) automated matches {Microbacterium hydrocarbonoxydans [TaxId: 273678]}
prrtvvlaidlqagvtpgcfdeegvlsraaalveraraggvpvvwvhhdpvgvgtpewel
aaplhraegeplvrknyrdsfadttlretldelgathlvitgaqsdfavrttmqraaaeg
ydvtlvsdahttvdtewegvrisgeqivahtnmyfsglrypgqefviathdhval

SCOPe Domain Coordinates for d5hwha_:

Click to download the PDB-style file with coordinates for d5hwha_.
(The format of our PDB-style files is described here.)

Timeline for d5hwha_:

  • d5hwha_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02