SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h5jb_ (5h5j B:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2159798Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2159799Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 protein domains)
  6. 2159928Protein automated matches [190231] (9 species)
    not a true protein
  7. 2285886Species Zea mays [TaxId:4577] [329187] (2 PDB entries)
  8. 2285888Domain d5h5jb_: 5h5j B: [329189]
    Other proteins in same PDB: d5h5ja1, d5h5ja2, d5h5jc1, d5h5jc2
    automated match to d2pvgc_
    complexed with fad, fes

Details for d5h5jb_

PDB Entry: 5h5j (more details), 2.5 Å

PDB Description: complex between ferredoxin and ferredoxin-nadp+ reductase from maize root
PDB Compounds: (B:) Ferredoxin-3, chloroplastic

SCOPe Domain Sequences for d5h5jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h5jb_ d.15.4.1 (B:) automated matches {Zea mays [TaxId: 4577]}
avykvklvgpegeehefdapddayildaaetagvelpyscragacstcagkiesgsvdqs
dgsflddgqqeegyvltcvsypksdcvihthkegdly

SCOPe Domain Coordinates for d5h5jb_:

Click to download the PDB-style file with coordinates for d5h5jb_.
(The format of our PDB-style files is described here.)

Timeline for d5h5jb_:

  • d5h5jb_ appears in periodic updates to SCOPe 2.06 starting on 2017-02-02