Lineage for d5h57e_ (5h57 E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179171Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2179304Protein automated matches [190231] (9 species)
    not a true protein
  7. 2179347Species Zea mays [TaxId:4577] [329187] (2 PDB entries)
  8. 2179352Domain d5h57e_: 5h57 E: [329188]
    automated match to d2pvgc_
    complexed with fes

Details for d5h57e_

PDB Entry: 5h57 (more details), 2.5 Å

PDB Description: ferredoxin iii from maize root
PDB Compounds: (E:) Ferredoxin-3, chloroplastic

SCOPe Domain Sequences for d5h57e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h57e_ d.15.4.1 (E:) automated matches {Zea mays [TaxId: 4577]}
avykvklvgpegeehefdapddayildaaetagvelpyscragacstcagkiesgsvdqs
dgsflddgqqeegyvltcvsypksdcvihthkegdly

SCOPe Domain Coordinates for d5h57e_:

Click to download the PDB-style file with coordinates for d5h57e_.
(The format of our PDB-style files is described here.)

Timeline for d5h57e_: