Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) binds NADP differently than classical Rossmann-fold N-terminal FAD-linked domain contains (6,10) barrel |
Family c.25.1.0: automated matches [227163] (1 protein) not a true family |
Protein automated matches [226871] (18 species) not a true protein |
Species Maize (Zea mays) [TaxId:4577] [226538] (17 PDB entries) |
Domain d5h5ja2: 5h5j A:158-317 [329185] Other proteins in same PDB: d5h5ja1, d5h5jb_, d5h5jc1 automated match to d3lo8a2 complexed with fad, fes |
PDB Entry: 5h5j (more details), 2.5 Å
SCOPe Domain Sequences for d5h5ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h5ja2 c.25.1.0 (A:158-317) automated matches {Maize (Zea mays) [TaxId: 4577]} mllpeedpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllyd eeftsylkqypdnfrydkvlsreqknrsggkmyvqdkieeysdeifklldggahiyfcgl kgmmpgiqdtlkkvaerrgeswdqklaqlkknkqwhvevy
Timeline for d5h5ja2: