SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5h5ja2 (5h5j A:158-317)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105127Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2105128Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2105290Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2105291Protein automated matches [226871] (18 species)
    not a true protein
  7. 2105324Species Maize (Zea mays) [TaxId:4577] [226538] (7 PDB entries)
  8. 2285884Domain d5h5ja2: 5h5j A:158-317 [329185]
    Other proteins in same PDB: d5h5ja1, d5h5jb_, d5h5jc1
    automated match to d3lo8a2
    complexed with fad, fes

Details for d5h5ja2

PDB Entry: 5h5j (more details), 2.5 Å

PDB Description: complex between ferredoxin and ferredoxin-nadp+ reductase from maize root
PDB Compounds: (A:) ferredoxin--nadp reductase

SCOPe Domain Sequences for d5h5ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h5ja2 c.25.1.0 (A:158-317) automated matches {Maize (Zea mays) [TaxId: 4577]}
mllpeedpnathimiatgtgvapfrgylrrmfmedvpnyrfgglawlflgvansdsllyd
eeftsylkqypdnfrydkvlsreqknrsggkmyvqdkieeysdeifklldggahiyfcgl
kgmmpgiqdtlkkvaerrgeswdqklaqlkknkqwhvevy

SCOPe Domain Coordinates for d5h5ja2:

Click to download the PDB-style file with coordinates for d5h5ja2.
(The format of our PDB-style files is described here.)

Timeline for d5h5ja2:

  • d5h5ja2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02