SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5g5ea2 (5g5e A:85-221)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (60 species)
    not a true protein
  7. 2285879Species Mangifera indica [TaxId:29780] [329180] (3 PDB entries)
  8. 2285882Domain d5g5ea2: 5g5e A:85-221 [329183]
    Other proteins in same PDB: d5g5ea1
    automated match to d5agya2
    complexed with act, peg

Details for d5g5ea2

PDB Entry: 5g5e (more details), 1.8 Å

PDB Description: crystallographic structure of the tau class glutathione s- transferase migstu from mango mangifera indica l.
PDB Compounds: (A:) tau class glutathione s-transferase

SCOPe Domain Sequences for d5g5ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g5ea2 a.45.1.0 (A:85-221) automated matches {Mangifera indica [TaxId: 29780]}
ilpsdpydraiarfwaayldekwypslkgiasaqgeeakkaavdqvgeslaliedtyvkl
skgkpffggekigyldiafgcflgwlrvtektsgvkflneaktphlakwavrfcadpavk
dvmpeteklaefaklla

SCOPe Domain Coordinates for d5g5ea2:

Click to download the PDB-style file with coordinates for d5g5ea2.
(The format of our PDB-style files is described here.)

Timeline for d5g5ea2:

  • d5g5ea2 appears in periodic updates to SCOPe 2.06 starting on 2017-02-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5g5ea1