SCOPe 2.06: Domain d5g5fa1: 5g5f A:3-84

Lineage for d5g5fa1 (5g5f A:3-84)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Mangifera indica [TaxId:29780] [329178] (3 PDB entries)

8. Domain d5g5fa1: 5g5f A:3-84 [329179]
   Other proteins in same PDB: d5g5fa2
   automated match to d5agya1
   complexed with gsh, peg

Details for d5g5fa1

PDB Entry: 5g5f, 2.3 Å

PDB Description: crystallographic structure of the tau class glutathione s-transferase migstu in complex with reduced glutathione.

PDB Compounds: (A:) tau class glutathione s-transferase

SCOPe Domain Sequences for d5g5fa1:

Sequence; same for both SEQRES and ATOM records:

>d5g5fa1 c.47.1.0 (A:3-84) automated matches {Mangifera indica [TaxId: 29780]}
ksdvkllgawpspyvmraritlnvksvdyelleetlgsksdlllksnpvhkkipvlihnd
kpicesliivhyidefwssgps

Timeline for d5g5fa1:

• d5g5fa1 is new in SCOPe 2.06-stable
  
• d5g5fa1 appears in SCOPe 2.07
  
• d5g5fa1 appears in the current release, SCOPe 2.08