![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (171 species) not a true protein |
![]() | Species Mangifera indica [TaxId:29780] [329178] (3 PDB entries) |
![]() | Domain d5g5fa1: 5g5f A:3-84 [329179] Other proteins in same PDB: d5g5fa2 automated match to d5agya1 complexed with gsh, peg |
PDB Entry: 5g5f (more details), 2.3 Å
SCOPe Domain Sequences for d5g5fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g5fa1 c.47.1.0 (A:3-84) automated matches {Mangifera indica [TaxId: 29780]} ksdvkllgawpspyvmraritlnvksvdyelleetlgsksdlllksnpvhkkipvlihnd kpicesliivhyidefwssgps
Timeline for d5g5fa1: