Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (10 families) |
Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (3 proteins) |
Protein Glutathione S-transferase [52863] (24 species) |
Species Human (Homo sapiens), class mu [TaxId:9606] [52867] (7 PDB entries) |
Domain d4gtuc2: 4gtu C:1-84 [32917] Other proteins in same PDB: d4gtua1, d4gtub1, d4gtuc1, d4gtud1, d4gtue1, d4gtuf1, d4gtug1, d4gtuh1 |
PDB Entry: 4gtu (more details), 3.3 Å
SCOP Domain Sequences for d4gtuc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gtuc2 c.47.1.5 (C:1-84) Glutathione S-transferase {Human (Homo sapiens), class mu} smtlgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgahkitqsnailcyiarkhn
Timeline for d4gtuc2: