Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (165 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (106 PDB entries) |
Domain d5b8ai_: 5b8a I: [329165] automated match to d4k1fa_ complexed with gol, so4 |
PDB Entry: 5b8a (more details), 2.7 Å
SCOPe Domain Sequences for d5b8ai_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b8ai_ c.47.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mslintkikpfknqafkngefieitekdtegrwsvfffypadftfvcptelgdvadhyee lqklgvdvyavstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladr atfvvdpqgiiqaievtaegigrdasdllrkikaaqyvashp
Timeline for d5b8ai_: