SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ugyf_ (5ugy F:)

  1. Root: SCOPe 2.06
  2. 2237529Class h: Coiled coil proteins [57942] (7 folds)
  3. 2238933Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2238934Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2238935Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 protein domains)
  6. 2238936Protein Influenza hemagglutinin (stalk) [58066] (11 species)
    trimer
  7. 2238958Species Influenza A virus, different strains [TaxId:11320] [58067] (118 PDB entries)
  8. 2285852Domain d5ugyf_: 5ugy F: [329153]
    Other proteins in same PDB: d5ugya1, d5ugya2, d5ugyc1, d5ugyc2, d5ugye1, d5ugye2, d5ugyl1, d5ugyl2, d5ugym1, d5ugym2, d5ugyn1, d5ugyn2
    automated match to d3sm5b_
    complexed with bma, nag

Details for d5ugyf_

PDB Entry: 5ugy (more details), 2.8 Å

PDB Description: influenza hemagglutinin in complex with a neutralizing antibody
PDB Compounds: (F:) hemagglutinin HA2

SCOPe Domain Sequences for d5ugyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ugyf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnreki

SCOPe Domain Coordinates for d5ugyf_:

Click to download the PDB-style file with coordinates for d5ugyf_.
(The format of our PDB-style files is described here.)

Timeline for d5ugyf_:

  • d5ugyf_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26