Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.0: automated matches [191547] (1 protein) not a true family |
Protein automated matches [190942] (7 species) not a true protein |
Species Brucella abortus [TaxId:359391] [329148] (1 PDB entry) |
Domain d5ufta1: 5uft A:1-143 [329149] Other proteins in same PDB: d5ufta2 automated match to d2qq4b_ |
PDB Entry: 5uft (more details), 2.35 Å
SCOPe Domain Sequences for d5ufta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ufta1 d.224.1.0 (A:1-143) automated matches {Brucella abortus [TaxId: 359391]} middiynkrilefagnmerigqlaepdavatvhsklcgstvtvylkmrdgvvtdfahevk acalgqasssvmarnvigatadelraardamyrmlkengpapegrfadmkyfepvrdyka rhastlltfdavadcirqieeka
Timeline for d5ufta1: