SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ufta1 (5uft A:1-143)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213792Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 2213793Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 2213847Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 2213848Protein automated matches [190942] (4 species)
    not a true protein
  7. 2285847Species Brucella abortus [TaxId:359391] [329148] (1 PDB entry)
  8. 2285848Domain d5ufta1: 5uft A:1-143 [329149]
    Other proteins in same PDB: d5ufta2
    automated match to d2qq4b_

Details for d5ufta1

PDB Entry: 5uft (more details), 2.35 Å

PDB Description: crystal structure of a nitrogen-fixing nifu-like protein (n-terminal) from brucella abortus
PDB Compounds: (A:) Nitrogen-fixing NifU-like, N-terminal

SCOPe Domain Sequences for d5ufta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ufta1 d.224.1.0 (A:1-143) automated matches {Brucella abortus [TaxId: 359391]}
middiynkrilefagnmerigqlaepdavatvhsklcgstvtvylkmrdgvvtdfahevk
acalgqasssvmarnvigatadelraardamyrmlkengpapegrfadmkyfepvrdyka
rhastlltfdavadcirqieeka

SCOPe Domain Coordinates for d5ufta1:

Click to download the PDB-style file with coordinates for d5ufta1.
(The format of our PDB-style files is described here.)

Timeline for d5ufta1:

  • d5ufta1 appears in periodic updates to SCOPe 2.06 starting on 2017-01-26

View in 3D
Domains from same chain:
(mouse over for more information)
d5ufta2