Lineage for d5ufta1 (5uft A:1-143)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007687Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 3007688Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 3007772Family d.224.1.0: automated matches [191547] (1 protein)
    not a true family
  6. 3007773Protein automated matches [190942] (7 species)
    not a true protein
  7. 3007782Species Brucella abortus [TaxId:359391] [329148] (1 PDB entry)
  8. 3007783Domain d5ufta1: 5uft A:1-143 [329149]
    Other proteins in same PDB: d5ufta2
    automated match to d2qq4b_

Details for d5ufta1

PDB Entry: 5uft (more details), 2.35 Å

PDB Description: crystal structure of a nitrogen-fixing nifu-like protein (n-terminal) from brucella abortus
PDB Compounds: (A:) Nitrogen-fixing NifU-like, N-terminal

SCOPe Domain Sequences for d5ufta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ufta1 d.224.1.0 (A:1-143) automated matches {Brucella abortus [TaxId: 359391]}
middiynkrilefagnmerigqlaepdavatvhsklcgstvtvylkmrdgvvtdfahevk
acalgqasssvmarnvigatadelraardamyrmlkengpapegrfadmkyfepvrdyka
rhastlltfdavadcirqieeka

SCOPe Domain Coordinates for d5ufta1:

Click to download the PDB-style file with coordinates for d5ufta1.
(The format of our PDB-style files is described here.)

Timeline for d5ufta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ufta2